| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (26 species) not a true protein |
| Species Naja sagittifera [TaxId:195058] [188129] (2 PDB entries) |
| Domain d1yxha_: 1yxh A: [162322] automated match to d1a3da_ complexed with ca, eoh, po4 |
PDB Entry: 1yxh (more details), 1.86 Å
SCOPe Domain Sequences for d1yxha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yxha_ a.133.1.2 (A:) automated matches {Naja sagittifera [TaxId: 195058]}
niyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncynqaqeitgc
rpkwktytyecsqgtltckgrnnacaatvcdcdrlaaicfagapyndnnynidlkarcq
Timeline for d1yxha_: