SCOPe 2.05: Domain d1yxha_: 1yxh A:

Lineage for d1yxha_ (1yxh A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (25 species)
   not a true protein

7. Species Naja sagittifera [TaxId:195058] [188129] (2 PDB entries)

8. Domain d1yxha_: 1yxh A: [162322]
   automated match to d1a3da_
   complexed with ca, eoh, po4

Details for d1yxha_

PDB Entry: 1yxh, 1.86 Å

PDB Description: Crystal structure of a novel phospholipase A2 from Naja naja sagittifera with a strong anticoagulant activity

PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1yxha_:

Sequence; same for both SEQRES and ATOM records:

>d1yxha_ a.133.1.2 (A:) automated matches {Naja sagittifera [TaxId: 195058]}
niyqfknmiqctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncynqaqeitgc
rpkwktytyecsqgtltckgrnnacaatvcdcdrlaaicfagapyndnnynidlkarcq

Timeline for d1yxha_:

• d1yxha_ first appeared in SCOPe 2.01
  
• d1yxha_ appears in SCOPe 2.04
  
• d1yxha_ appears in SCOPe 2.06
  
• d1yxha_ appears in the current release, SCOPe 2.08