SCOPe 2.03: Domain d1ywtb_: 1ywt B:

Lineage for d1ywtb_ (1ywt B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (37 PDB entries)

8. Domain d1ywtb_: 1ywt B: [162320]
   automated match to d1qjba_
   complexed with ca

Details for d1ywtb_

PDB Entry: 1ywt, 2.4 Å

PDB Description: Crystal structure of the human sigma isoform of 14-3-3 in complex with a mode-1 phosphopeptide

PDB Compounds: (B:) 14-3-3 protein sigma

SCOPe Domain Sequences for d1ywtb_:

Sequence, based on SEQRES records:

>d1ywtb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records):

>d1ywtb_ a.118.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqkspevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgdyyr
ylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeianspee
aislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Timeline for d1ywtb_:

• d1ywtb_ first appeared in SCOPe 2.01
  
• d1ywtb_ appears in SCOPe 2.02
  
• d1ywtb_ appears in SCOPe 2.04
  
• d1ywtb_ appears in the current release, SCOPe 2.08