Lineage for d1ywpa1 (1ywp A:1-61)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783348Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries)
  8. 2783351Domain d1ywpa1: 1ywp A:1-61 [162317]
    Other proteins in same PDB: d1ywpa2
    automated match to d1hsqa_

Details for d1ywpa1

PDB Entry: 1ywp (more details), 1.6 Å

PDB Description: phospholipase cgamma1 sh3
PDB Compounds: (A:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1

SCOPe Domain Sequences for d1ywpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywpa1 b.34.2.1 (A:1-61) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptfksavkalfdykaqredeltftksaiiqnvekqdggwwrgdyggkkqlwfpsnyveem
i

SCOPe Domain Coordinates for d1ywpa1:

Click to download the PDB-style file with coordinates for d1ywpa1.
(The format of our PDB-style files is described here.)

Timeline for d1ywpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ywpa2