| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein automated matches [190043] (8 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries) |
| Domain d1ywpa1: 1ywp A:1-61 [162317] Other proteins in same PDB: d1ywpa2 automated match to d1hsqa_ |
PDB Entry: 1ywp (more details), 1.6 Å
SCOPe Domain Sequences for d1ywpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ywpa1 b.34.2.1 (A:1-61) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptfksavkalfdykaqredeltftksaiiqnvekqdggwwrgdyggkkqlwfpsnyveem
i
Timeline for d1ywpa1: