Lineage for d1ywoa_ (1ywo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783348Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (7 PDB entries)
  8. 2783354Domain d1ywoa_: 1ywo A: [162316]
    automated match to d1hsqa_

Details for d1ywoa_

PDB Entry: 1ywo (more details), 1.81 Å

PDB Description: phospholipase cgamma1 sh3 in complex with a slp-76 motif
PDB Compounds: (A:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1

SCOPe Domain Sequences for d1ywoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywoa_ b.34.2.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
savkalfdykaqredeltftksaiiqnvekqdggwwrgdyggkkqlwfpsnyvee

SCOPe Domain Coordinates for d1ywoa_:

Click to download the PDB-style file with coordinates for d1ywoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ywoa_: