Lineage for d1yv7a_ (1yv7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535185Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2535186Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2535187Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2535659Protein automated matches [190061] (7 species)
    not a true protein
  7. 2535778Species Frog (Rana pipiens) [TaxId:8404] [188156] (4 PDB entries)
  8. 2535782Domain d1yv7a_: 1yv7 A: [162310]
    automated match to d1onca_
    complexed with so4

Details for d1yv7a_

PDB Entry: 1yv7 (more details), 1.9 Å

PDB Description: x-ray structure of (c87s,des103-104) onconase
PDB Compounds: (A:) P-30 protein

SCOPe Domain Sequences for d1yv7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yv7a_ d.5.1.1 (A:) automated matches {Frog (Rana pipiens) [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfsvtcenqapvhfvgvg

SCOPe Domain Coordinates for d1yv7a_:

Click to download the PDB-style file with coordinates for d1yv7a_.
(The format of our PDB-style files is described here.)

Timeline for d1yv7a_: