![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein automated matches [190061] (7 species) not a true protein |
![]() | Species Frog (Rana pipiens) [TaxId:8404] [188156] (4 PDB entries) |
![]() | Domain d1yv7a_: 1yv7 A: [162310] automated match to d1onca_ complexed with so4 |
PDB Entry: 1yv7 (more details), 1.9 Å
SCOPe Domain Sequences for d1yv7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yv7a_ d.5.1.1 (A:) automated matches {Frog (Rana pipiens) [TaxId: 8404]} edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt sefylsdcnvtsrpckyklkkstnkfsvtcenqapvhfvgvg
Timeline for d1yv7a_: