![]() | Class a: All alpha proteins [46456] (138 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies) |
![]() | Superfamily a.4.6: C-terminal, effector domain of the bipartite response regulators [46894] (3 families) ![]() |
![]() | Family a.4.6.1: PhoB-like [46895] (2 proteins) |
![]() | Protein OmpR [46896] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46897] (2 PDB entries) |
![]() | Domain d1opc__: 1opc - [16231] |
PDB Entry: 1opc (more details), 1.95 Å
SCOP Domain Sequences for d1opc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opc__ a.4.6.1 (-) OmpR {Escherichia coli} viafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreysa mersidvqisrlrrmveedpahpryiqtvwglgyvfvpd
Timeline for d1opc__: