![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.1: PhoB-like [46895] (6 proteins) contains 4-stranded meander beta-sheet in the N-terminal extension |
![]() | Protein OmpR [46896] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [46897] (3 PDB entries) |
![]() | Domain d1opca_: 1opc A: [16231] |
PDB Entry: 1opc (more details), 1.95 Å
SCOPe Domain Sequences for d1opca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opca_ a.4.6.1 (A:) OmpR {Escherichia coli [TaxId: 562]} viafgkfklnlgtremfredepmpltsgefavlkalvshpreplsrdklmnlargreysa mersidvqisrlrrmveedpahpryiqtvwglgyvfvpd
Timeline for d1opca_: