Lineage for d1yv6a_ (1yv6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928018Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 2928032Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)
  8. 2928040Domain d1yv6a_: 1yv6 A: [162309]
    automated match to d1onca_
    complexed with so4

Details for d1yv6a_

PDB Entry: 1yv6 (more details), 1.78 Å

PDB Description: x-ray structure of m23l onconase at 298k
PDB Compounds: (A:) P-30 protein

SCOPe Domain Sequences for d1yv6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yv6a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnilstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

SCOPe Domain Coordinates for d1yv6a_:

Click to download the PDB-style file with coordinates for d1yv6a_.
(The format of our PDB-style files is described here.)

Timeline for d1yv6a_: