| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
| Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
| Protein Amphibian cytotoxic ribonuclease [54084] (5 species) |
| Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries) |
| Domain d1yv4a_: 1yv4 A: [162308] automated match to d1onca_ complexed with so4 |
PDB Entry: 1yv4 (more details), 1.51 Å
SCOPe Domain Sequences for d1yv4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yv4a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnilstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc
Timeline for d1yv4a_: