Lineage for d1yv4a_ (1yv4 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1399946Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1399947Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1399948Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1399949Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 1399963Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)
  8. 1399966Domain d1yv4a_: 1yv4 A: [162308]
    automated match to d1onca_
    complexed with so4

Details for d1yv4a_

PDB Entry: 1yv4 (more details), 1.51 Å

PDB Description: x-ray structure of m23l onconase at 100k
PDB Compounds: (A:) P-30 protein

SCOPe Domain Sequences for d1yv4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yv4a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnilstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

SCOPe Domain Coordinates for d1yv4a_:

Click to download the PDB-style file with coordinates for d1yv4a_.
(The format of our PDB-style files is described here.)

Timeline for d1yv4a_: