Lineage for d1yuya_ (1yuy A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. Protein automated matches [190260] (25 species)
    not a true protein
  7. Species Hepatitis C virus [TaxId:11103] [187048] (44 PDB entries)
  8. Domain d1yuya_: 1yuy A: [162306]
    automated match to d1nb4a_
    complexed with so4

Details for d1yuya_

PDB Entry: 1yuy (more details), 1.9 Å

PDB Description: hepatitis c virus ns5b rna-dependent rna polymerase genotype 2a
PDB Compounds: (A:) RNA-dependent RNA polymerase

SCOPe Domain Sequences for d1yuya_:

Sequence, based on SEQRES records: (download)

>d1yuya_ e.8.1.4 (A:) automated matches {Hepatitis C virus [TaxId: 11103]}
smsyswtgalitpcspeeeklpinplsnsllryhnkvycttsksaslrakkvtfdrmqvl
dayydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
svwkdlledsqtpipttimaknevfcvdptkggkkaarlivypdlgvrvcekmalydvtq
klpqavmgasygfqyspaqrvefllkawaekkdpmgfsydtrcfdstvterdirteesiy
qacslpeeartaihslterlyvggpmfnskgqscgyrrcrasgvlttsmgntitcyvkal
aackaagivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydl
elitscssnvsvalgpqgrrryyltrdpttpiaraawetvrhspvnswlgniiqyaptiw
vrmvlmthffsilmaqdtldqnlnfemygsvysvspldlpaiierlhgldafslhtytph
eltrvasalrklgapplrawksraravraslisrggraavcgrylfnwavktklkltplp
earlldlsswftvgagggdiyhs

Sequence, based on observed residues (ATOM records): (download)

>d1yuya_ e.8.1.4 (A:) automated matches {Hepatitis C virus [TaxId: 11103]}
smsyswtgalitpcspeeeklpinplsnsllryhnkvycttsksaslrakkvtfdrmqvl
dayydsvlkdiklaaskvsarlltleeacqltpphsarskygfgakevrslsgravnhik
svwkdlledsqtpipttimaknevfcvdkkaarlivypdlgvrvcekmalydvtqklpqa
vmgasygfqyspaqrvefllkawaekkdpmgfsydtrcfdstvterdirteesiyqacsl
peeartaihslterlyvggpmfnskgqscgyrrcrasgvlttsmgntitcyvkalaacka
agivaptmlvcgddlvvisesqgteedernlrafteamtrysappgdpprpeydlelits
cssnvsvalgpqgrrryyltrdpttpiaraawetvrhspvnswlgniiqyaptiwvrmvl
mthffsilmaqdtldqnlnfemygsvysvspldlpaiierlhgldafslhtytpheltrv
asalrklgapplrawksraravraslisrggraavcgrylfnwavktklkltplpearll
dlsswftvgagggdiyhs

SCOPe Domain Coordinates for d1yuya_ are not available.

Timeline for d1yuya_: