![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
![]() | Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
![]() | Protein Uracil-DNA glycosylase [52143] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52144] (16 PDB entries) |
![]() | Domain d1yuoa_: 1yuo A: [162305] automated match to d1akza_ |
PDB Entry: 1yuo (more details), 1.95 Å
SCOPe Domain Sequences for d1yuoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yuoa_ c.18.1.1 (A:) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi lgqdpyhgpnqahglcfsvqrpvppppslvniykelstdiedfvhpghgdlsgwakqgvl llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
Timeline for d1yuoa_: