Lineage for d1yuca_ (1yuc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342588Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 2342614Domain d1yuca_: 1yuc A: [162303]
    automated match to d1pk5a_
    complexed with eph, gol

Details for d1yuca_

PDB Entry: 1yuc (more details), 1.9 Å

PDB Description: human nuclear receptor liver receptor homologue-1, lrh-1, bound to phospholipid and a fragment of human shp
PDB Compounds: (A:) Orphan nuclear receptor NR5A2

SCOPe Domain Sequences for d1yuca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuca_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asiphlilellkcepdepqvqakimaylqqeqanrskheklstfglmckmadqtlfsive
warssiffrelkvddqmkllqncwsellildhiyrqvvhgkegsiflvtgqqvdysiias
qagatlnnlmshaqelvaklrslqfdqrefvclkflvlfsldvknlenfqlvegvqeqvn
aalldytmcnypqqtekfgqlllrlpeiraismqaeeylyykhlngdvpynnlliemlha

SCOPe Domain Coordinates for d1yuca_:

Click to download the PDB-style file with coordinates for d1yuca_.
(The format of our PDB-style files is described here.)

Timeline for d1yuca_: