Lineage for d1yu7x_ (1yu7 X:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309889Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 2309890Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) (S)
  5. 2309891Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)
  6. 2309901Protein Villin [47052] (2 species)
  7. 2309902Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries)
  8. 2309907Domain d1yu7x_: 1yu7 X: [162302]
    automated match to d1qqva_
    mutant

Details for d1yu7x_

PDB Entry: 1yu7 (more details), 1.5 Å

PDB Description: Crystal Structure of the W64Y mutant of Villin Headpiece
PDB Compounds: (X:) villin

SCOPe Domain Sequences for d1yu7x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yu7x_ a.14.1.1 (X:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
letfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafanlplykqqnlkke
kglf

SCOPe Domain Coordinates for d1yu7x_:

Click to download the PDB-style file with coordinates for d1yu7x_.
(The format of our PDB-style files is described here.)

Timeline for d1yu7x_: