Lineage for d1yt4a_ (1yt4 A:)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1232773Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1232774Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1232775Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1232943Protein beta-Lactamase, class A [56606] (15 species)
  7. 1232966Species Escherichia coli, TEM-1 [TaxId:562] [56607] (35 PDB entries)
  8. 1232969Domain d1yt4a_: 1yt4 A: [162301]
    automated match to d1axba_

Details for d1yt4a_

PDB Entry: 1yt4 (more details), 1.4 Å

PDB Description: crystal structure of tem-76 beta-lactamase at 1.4 angstrom resolution
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d1yt4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yt4a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmgdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d1yt4a_:

Click to download the PDB-style file with coordinates for d1yt4a_.
(The format of our PDB-style files is described here.)

Timeline for d1yt4a_: