Class a: All alpha proteins [46456] (289 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) |
Family a.6.1.7: Excisionase-like [46891] (2 proteins) kinked C-terminal helix |
Protein mu transposase, DNA-binding domain [46892] (1 species) |
Species Bacteriophage Mu [TaxId:10677] [46893] (4 PDB entries) |
Domain d1qpma_: 1qpm A: [16230] |
PDB Entry: 1qpm (more details)
SCOPe Domain Sequences for d1qpma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpma_ a.6.1.7 (A:) mu transposase, DNA-binding domain {Bacteriophage Mu [TaxId: 10677]} ksiwcspqeimaadgmpgsvagvhyranvqgwtkrkkegvkggkaveydvmsmptkereq viahlglst
Timeline for d1qpma_: