Lineage for d1qpma_ (1qpm A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696452Family a.6.1.7: Excisionase-like [46891] (2 proteins)
    kinked C-terminal helix
  6. 2696464Protein mu transposase, DNA-binding domain [46892] (1 species)
  7. 2696465Species Bacteriophage Mu [TaxId:10677] [46893] (4 PDB entries)
  8. 2696466Domain d1qpma_: 1qpm A: [16230]

Details for d1qpma_

PDB Entry: 1qpm (more details)

PDB Description: nmr structure of the mu bacteriophage repressor dna-binding domain
PDB Compounds: (A:) protein (mu bacteriophage c repressor protein)

SCOPe Domain Sequences for d1qpma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpma_ a.6.1.7 (A:) mu transposase, DNA-binding domain {Bacteriophage Mu [TaxId: 10677]}
ksiwcspqeimaadgmpgsvagvhyranvqgwtkrkkegvkggkaveydvmsmptkereq
viahlglst

SCOPe Domain Coordinates for d1qpma_:

Click to download the PDB-style file with coordinates for d1qpma_.
(The format of our PDB-style files is described here.)

Timeline for d1qpma_: