Lineage for d1tnta_ (1tnt A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724238Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1724239Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1724336Family a.6.1.7: Excisionase-like [46891] (2 proteins)
    kinked C-terminal helix
  6. 1724348Protein mu transposase, DNA-binding domain [46892] (1 species)
  7. 1724349Species Bacteriophage Mu [TaxId:10677] [46893] (4 PDB entries)
  8. 1724353Domain d1tnta_: 1tnt A: [16229]

Details for d1tnta_

PDB Entry: 1tnt (more details)

PDB Description: a novel class of winged helix-turn-helix protein: the dna-binding domain of mu transposase
PDB Compounds: (A:) mu-transposase

SCOPe Domain Sequences for d1tnta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnta_ a.6.1.7 (A:) mu transposase, DNA-binding domain {Bacteriophage Mu [TaxId: 10677]}
melwvspkelanlpglpktsagviyvakkqgwqnrtragvkggkaieynanslpveakaa
lllrqgeietslgyfe

SCOPe Domain Coordinates for d1tnta_:

Click to download the PDB-style file with coordinates for d1tnta_.
(The format of our PDB-style files is described here.)

Timeline for d1tnta_: