Lineage for d1tnt__ (1tnt -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352497Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 352498Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) (S)
  5. 352554Family a.6.1.7: Excisionase-like [46891] (2 proteins)
    kinked C-terminal helix
  6. 352559Protein mu transposase, DNA-binding domain [46892] (1 species)
  7. 352560Species Bacteriophage mu [TaxId:10677] [46893] (4 PDB entries)
  8. 352563Domain d1tnt__: 1tnt - [16229]

Details for d1tnt__

PDB Entry: 1tnt (more details)

PDB Description: a novel class of winged helix-turn-helix protein: the dna-binding domain of mu transposase

SCOP Domain Sequences for d1tnt__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnt__ a.6.1.7 (-) mu transposase, DNA-binding domain {Bacteriophage mu}
melwvspkelanlpglpktsagviyvakkqgwqnrtragvkggkaieynanslpveakaa
lllrqgeietslgyfe

SCOP Domain Coordinates for d1tnt__:

Click to download the PDB-style file with coordinates for d1tnt__.
(The format of our PDB-style files is described here.)

Timeline for d1tnt__: