Lineage for d1yrqd_ (1yrq D:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019034Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 3019069Protein automated matches [190110] (7 species)
    not a true protein
  7. 3019109Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)
  8. 3019137Domain d1yrqd_: 1yrq D: [162289]
    Other proteins in same PDB: d1yrqh_, d1yrqi_, d1yrqj_, d1yrqk_, d1yrqm_, d1yrqn_
    automated match to d1frfs_
    complexed with f3s, fco, mg, ni, sf4

Details for d1yrqd_

PDB Entry: 1yrq (more details), 2.1 Å

PDB Description: structure of the ready oxidized form of [nife]-hydrogenase
PDB Compounds: (D:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d1yrqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrqd_ e.19.1.1 (D:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d1yrqd_:

Click to download the PDB-style file with coordinates for d1yrqd_.
(The format of our PDB-style files is described here.)

Timeline for d1yrqd_: