Lineage for d1yrqb_ (1yrq B:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1453668Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1453669Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1453670Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 1453700Protein automated matches [190110] (5 species)
    not a true protein
  7. 1453714Species Desulfovibrio fructosovorans [TaxId:878] [188149] (5 PDB entries)
  8. 1453719Domain d1yrqb_: 1yrq B: [162287]
    Other proteins in same PDB: d1yrqh_, d1yrqi_, d1yrqj_, d1yrqk_, d1yrqm_, d1yrqn_
    automated match to d1frfs_
    complexed with f3s, fco, mg, ni, sf4

Details for d1yrqb_

PDB Entry: 1yrq (more details), 2.1 Å

PDB Description: structure of the ready oxidized form of [nife]-hydrogenase
PDB Compounds: (B:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d1yrqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrqb_ e.19.1.1 (B:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldsngrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d1yrqb_:

Click to download the PDB-style file with coordinates for d1yrqb_.
(The format of our PDB-style files is described here.)

Timeline for d1yrqb_: