SCOPe 2.06: Domain d1yrka1: 1yrk A:1-123

Lineage for d1yrka1 (1yrk A:1-123)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)

6. Protein automated matches [190564] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188151] (4 PDB entries)

8. Domain d1yrka1: 1yrk A:1-123 [162285]
   Other proteins in same PDB: d1yrka2
   automated match to d1bdya_
   complexed with acy

Details for d1yrka1

PDB Entry: 1yrk, 1.7 Å

PDB Description: The C2 Domain of PKC is a new Phospho-Tyrosine Binding Domain

PDB Compounds: (A:) Protein kinase C, delta type

SCOPe Domain Sequences for d1yrka1:

Sequence; same for both SEQRES and ATOM records:

>d1yrka1 b.7.1.1 (A:1-123) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mapflriafnsyelgslqaedeanqpfcavkmkealstergktlvqkkptmypewkstfd
ahiyegrviqivlmraaeepvsevtvgvsvlaerckknngkaefwldlqpqakvlmsvqy
fle

Timeline for d1yrka1:

• d1yrka1 first appeared in SCOPe 2.01, called d1yrka_
  
• d1yrka1 was called d1yrka_ in SCOPe 2.05
  
• d1yrka1 appears in SCOPe 2.07
  
• d1yrka1 appears in the current release, SCOPe 2.08