SCOPe 2.03: Domain d1yqwc_: 1yqw C:

Lineage for d1yqwc_ (1yqw C:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (5 species)
   not a true protein

7. Species Desulfovibrio fructosovorans [TaxId:878] [188149] (5 PDB entries)

8. Domain d1yqwc_: 1yqw C: [162281]
   Other proteins in same PDB: d1yqwq_, d1yqwr_, d1yqws_
   automated match to d1frfs_
   complexed with bct, f3s, fco, fe2, gol, mg, ni, per, sf4

Details for d1yqwc_

PDB Entry: 1yqw, 1.83 Å

PDB Description: structure of the oxidized unready form of ni-fe hydrogenase

PDB Compounds: (C:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d1yqwc_:

Sequence; same for both SEQRES and ATOM records:

>d1yqwc_ e.19.1.1 (C:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
hrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhqal
egkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqkak
pnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygelvh
dncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqaghp
clgcsepdfwdtmtpfyeqg

Timeline for d1yqwc_:

• d1yqwc_ first appeared in SCOPe 2.01
  
• d1yqwc_ appears in SCOPe 2.02
  
• d1yqwc_ appears in SCOPe 2.04
  
• d1yqwc_ appears in the current release, SCOPe 2.08