Class a: All alpha proteins [46456] (202 folds) |
Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) |
Family a.6.1.7: Excisionase-like [46891] (2 proteins) kinked C-terminal helix |
Protein mu transposase, DNA-binding domain [46892] (1 species) |
Species Bacteriophage mu [TaxId:10677] [46893] (4 PDB entries) |
Domain d1tns__: 1tns - [16228] |
PDB Entry: 1tns (more details)
SCOP Domain Sequences for d1tns__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tns__ a.6.1.7 (-) mu transposase, DNA-binding domain {Bacteriophage mu} melwvspkelanlpglpktsagviyvakkqgwqnrtragvkggkaieynanslpveakaa lllrqgeietslgyfe
Timeline for d1tns__: