SCOP 1.67: Domain d1tns__: 1tns -

Lineage for d1tns__ (1tns -)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families)

5. Family a.6.1.7: Excisionase-like [46891] (2 proteins)
   kinked C-terminal helix

6. Protein mu transposase, DNA-binding domain [46892] (1 species)

7. Species Bacteriophage mu [TaxId:10677] [46893] (4 PDB entries)

8. Domain d1tns__: 1tns - [16228]

Details for d1tns__

PDB Entry: 1tns

PDB Description: a novel class of winged helix-turn-helix protein: the dna-binding domain of mu transposase

SCOP Domain Sequences for d1tns__:

Sequence; same for both SEQRES and ATOM records:

>d1tns__ a.6.1.7 (-) mu transposase, DNA-binding domain {Bacteriophage mu}
melwvspkelanlpglpktsagviyvakkqgwqnrtragvkggkaieynanslpveakaa
lllrqgeietslgyfe

Timeline for d1tns__:

• d1tns__ first appeared (with stable ids) in SCOP 1.55
  
• d1tns__ appears in SCOP 1.65
  
• d1tns__ appears in SCOP 1.69
  
• d1tns__ appears in the current release, SCOPe 2.08, called d1tnsa_