Lineage for d1yqwa_ (1yqw A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1694237Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1694238Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1694239Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 1694269Protein automated matches [190110] (5 species)
    not a true protein
  7. 1694283Species Desulfovibrio fructosovorans [TaxId:878] [188149] (6 PDB entries)
  8. 1694284Domain d1yqwa_: 1yqw A: [162279]
    Other proteins in same PDB: d1yqwq_, d1yqwr_, d1yqws_
    automated match to d1frfs_
    complexed with bct, f3s, fco, fe2, gol, mg, ni, per, sf4

Details for d1yqwa_

PDB Entry: 1yqw (more details), 1.83 Å

PDB Description: structure of the oxidized unready form of ni-fe hydrogenase
PDB Compounds: (A:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d1yqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqwa_ e.19.1.1 (A:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d1yqwa_:

Click to download the PDB-style file with coordinates for d1yqwa_.
(The format of our PDB-style files is described here.)

Timeline for d1yqwa_: