Lineage for d1yp1a_ (1yp1 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529463Family d.92.1.9: Reprolysin-like [55519] (3 proteins)
    Pfam PF01421
  6. 2529499Protein automated matches [190837] (3 species)
    not a true protein
  7. 2529504Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [188147] (1 PDB entry)
  8. 2529505Domain d1yp1a_: 1yp1 A: [162276]
    automated match to d1quaa_
    complexed with zn

Details for d1yp1a_

PDB Entry: 1yp1 (more details), 1.9 Å

PDB Description: Crystal structure of a non-hemorrhagic fibrin(ogen)olytic metalloproteinase from venom of Agkistrodon acutus
PDB Compounds: (A:) fii

SCOPe Domain Sequences for d1yp1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yp1a_ d.92.1.9 (A:) automated matches {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]}
aspqvsvtlqlvvdssmfakyngdakkivtvldtrvnimksifkpllllitlsgiemwts
kdlitvkpagdltlslfadwrqtlllsrilndnaqlqtavdfrgavvglafvgtmcnaky
sagiiqdfsaipllmavvmahelghnlgmlhddgyscdcdvcimapslssdptkvfsncs
lilyedflsneepdcidna

SCOPe Domain Coordinates for d1yp1a_:

Click to download the PDB-style file with coordinates for d1yp1a_.
(The format of our PDB-style files is described here.)

Timeline for d1yp1a_: