![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.9: Reprolysin-like [55519] (3 proteins) Pfam PF01421 |
![]() | Protein automated matches [190837] (3 species) not a true protein |
![]() | Species Sharp-nosed viper (Deinagkistrodon acutus) [TaxId:36307] [188147] (1 PDB entry) |
![]() | Domain d1yp1a_: 1yp1 A: [162276] automated match to d1quaa_ complexed with zn |
PDB Entry: 1yp1 (more details), 1.9 Å
SCOPe Domain Sequences for d1yp1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yp1a_ d.92.1.9 (A:) automated matches {Sharp-nosed viper (Deinagkistrodon acutus) [TaxId: 36307]} aspqvsvtlqlvvdssmfakyngdakkivtvldtrvnimksifkpllllitlsgiemwts kdlitvkpagdltlslfadwrqtlllsrilndnaqlqtavdfrgavvglafvgtmcnaky sagiiqdfsaipllmavvmahelghnlgmlhddgyscdcdvcimapslssdptkvfsncs lilyedflsneepdcidna
Timeline for d1yp1a_: