Lineage for d1yo3b_ (1yo3 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1024356Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 1024357Superfamily d.39.1: DLC [54648] (1 family) (S)
  5. 1024358Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 1024396Protein automated matches [190350] (2 species)
    not a true protein
  7. 1024399Species Plasmodium falciparum [TaxId:36329] [188146] (1 PDB entry)
  8. 1024401Domain d1yo3b_: 1yo3 B: [162272]
    automated match to d1f3ca_

Details for d1yo3b_

PDB Entry: 1yo3 (more details), 1.65 Å

PDB Description: 1.65 angstrom structure of the dynein light chain 1 from plasmodium falciparum
PDB Compounds: (B:) dynein light chain 1

SCOPe Domain Sequences for d1yo3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yo3b_ d.39.1.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
gsvvknvdmteemqidaidcanqalqkynvekdiaahikkefdrkydptwhcvvgrnfgs
yvthetknfiyfyigqvaillfksg

SCOPe Domain Coordinates for d1yo3b_:

Click to download the PDB-style file with coordinates for d1yo3b_.
(The format of our PDB-style files is described here.)

Timeline for d1yo3b_: