Lineage for d1g4da_ (1g4d A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1682Family a.4.5.26: mu transposase, DNA-binding domain [46891] (1 protein)
  6. 1683Protein mu transposase, DNA-binding domain [46892] (1 species)
  7. 1684Species Bacteriophage mu [TaxId:10677] [46893] (4 PDB entries)
  8. 1685Domain d1g4da_: 1g4d A: [16227]

Details for d1g4da_

PDB Entry: 1g4d (more details)

PDB Description: nmr structure of the mu bacteriophage repressor dna-binding domain/dna complex

SCOP Domain Sequences for d1g4da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4da_ a.4.5.26 (A:) mu transposase, DNA-binding domain {Bacteriophage mu}
ksiwcspqeimaadgmpgsvagvhyranvqgwtkrkkegvkggkaveydvmsmptkereq
viahlglst

SCOP Domain Coordinates for d1g4da_:

Click to download the PDB-style file with coordinates for d1g4da_.
(The format of our PDB-style files is described here.)

Timeline for d1g4da_: