SCOPe 2.01: Domain d1ynvx_: 1ynv X:

Lineage for d1ynvx_ (1ynv X:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein automated matches [190834] (1 species)
   not a true protein

7. Species Streptomyces aureofaciens [TaxId:1894] [188142] (7 PDB entries)

8. Domain d1ynvx_: 1ynv X: [162266]
   automated match to d1ay7a_
   complexed with so4

Details for d1ynvx_

PDB Entry: 1ynv, 1.2 Å

PDB Description: asp79 makes a large, unfavorable contribution to the stability of rnase sa

PDB Compounds: (X:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d1ynvx_:

Sequence; same for both SEQRES and ATOM records:

>d1ynvx_ d.1.1.2 (X:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidktc

Timeline for d1ynvx_:

• d1ynvx_ is new in SCOPe 2.01-stable
  
• d1ynvx_ appears in SCOPe 2.02
  
• d1ynvx_ appears in the current release, SCOPe 2.08