Lineage for d1ynvx_ (1ynv X:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2923793Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2923794Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2923795Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2923990Protein automated matches [190834] (3 species)
    not a true protein
  7. 2923999Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)
  8. 2924002Domain d1ynvx_: 1ynv X: [162266]
    automated match to d1ay7a_
    complexed with so4

Details for d1ynvx_

PDB Entry: 1ynv (more details), 1.2 Å

PDB Description: asp79 makes a large, unfavorable contribution to the stability of rnase sa
PDB Compounds: (X:) guanyl-specific ribonuclease sa

SCOPe Domain Sequences for d1ynvx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynvx_ d.1.1.2 (X:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriitgeatqedyytgdhyatfslidktc

SCOPe Domain Coordinates for d1ynvx_:

Click to download the PDB-style file with coordinates for d1ynvx_.
(The format of our PDB-style files is described here.)

Timeline for d1ynvx_: