Lineage for d1yn8e1 (1yn8 E:2-59)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783366Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries)
  8. 2783382Domain d1yn8e1: 1yn8 E:2-59 [162264]
    Other proteins in same PDB: d1yn8a2, d1yn8b2, d1yn8c2, d1yn8d2, d1yn8e2, d1yn8f2
    automated match to d1uj0a_
    complexed with ca

Details for d1yn8e1

PDB Entry: 1yn8 (more details), 1.7 Å

PDB Description: sh3 domain of yeast nbp2
PDB Compounds: (E:) NAP1-binding protein 2

SCOPe Domain Sequences for d1yn8e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yn8e1 b.34.2.0 (E:2-59) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq

SCOPe Domain Coordinates for d1yn8e1:

Click to download the PDB-style file with coordinates for d1yn8e1.
(The format of our PDB-style files is described here.)

Timeline for d1yn8e1: