Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (10 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries) |
Domain d1yn8c1: 1yn8 C:2-59 [162262] Other proteins in same PDB: d1yn8a2, d1yn8b2, d1yn8c2, d1yn8d2, d1yn8e2, d1yn8f2 automated match to d1uj0a_ complexed with ca |
PDB Entry: 1yn8 (more details), 1.7 Å
SCOPe Domain Sequences for d1yn8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yn8c1 b.34.2.0 (C:2-59) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
Timeline for d1yn8c1: