SCOPe 2.04: Domain d1yn8b_: 1yn8 B:

Lineage for d1yn8b_ (1yn8 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (12 PDB entries)

8. Domain d1yn8b_: 1yn8 B: [162261]
   automated match to d1uj0a_
   complexed with ca

Details for d1yn8b_

PDB Entry: 1yn8, 1.7 Å

PDB Description: sh3 domain of yeast nbp2

PDB Compounds: (B:) NAP1-binding protein 2

SCOPe Domain Sequences for d1yn8b_:

Sequence; same for both SEQRES and ATOM records:

>d1yn8b_ b.34.2.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq

Timeline for d1yn8b_:

• d1yn8b_ first appeared in SCOPe 2.01
  
• d1yn8b_ appears in SCOPe 2.03
  
• d1yn8b_ appears in SCOPe 2.05
  
• d1yn8b_ appears in the current release, SCOPe 2.08, called d1yn8b1