Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (5 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (6 PDB entries) |
Domain d1yn8b_: 1yn8 B: [162261] automated match to d1uj0a_ complexed with ca |
PDB Entry: 1yn8 (more details), 1.7 Å
SCOPe Domain Sequences for d1yn8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yn8b_ b.34.2.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq
Timeline for d1yn8b_: