Lineage for d1yn8a_ (1yn8 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946580Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 946581Protein automated matches [190457] (5 species)
    not a true protein
  7. 946584Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187372] (6 PDB entries)
  8. 946592Domain d1yn8a_: 1yn8 A: [162260]
    automated match to d1uj0a_
    complexed with ca

Details for d1yn8a_

PDB Entry: 1yn8 (more details), 1.7 Å

PDB Description: sh3 domain of yeast nbp2
PDB Compounds: (A:) NAP1-binding protein 2

SCOPe Domain Sequences for d1yn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yn8a_ b.34.2.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqravalydfependnelrlaegdivfisykhgqgwlvaenesgsktglvpeefvsyiq

SCOPe Domain Coordinates for d1yn8a_:

Click to download the PDB-style file with coordinates for d1yn8a_.
(The format of our PDB-style files is described here.)

Timeline for d1yn8a_: