Lineage for d1ymwa_ (1ymw A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1015692Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1015693Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1015694Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1015775Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 1015776Species Cow (Bos taurus) [TaxId:9913] [54079] (143 PDB entries)
  8. 1015820Domain d1ymwa_: 1ymw A: [162257]
    automated match to d1a2wa_
    mutant

Details for d1ymwa_

PDB Entry: 1ymw (more details), 1.5 Å

PDB Description: the study of reductive unfolding pathways of rnase a (y92g mutant)
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d1ymwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymwa_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskgpncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d1ymwa_:

Click to download the PDB-style file with coordinates for d1ymwa_.
(The format of our PDB-style files is described here.)

Timeline for d1ymwa_: