Lineage for d1ymna_ (1ymn A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174613Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 2174614Species Cow (Bos taurus) [TaxId:9913] [54079] (188 PDB entries)
  8. 2174638Domain d1ymna_: 1ymn A: [162253]
    automated match to d1a2wa_
    mutant

Details for d1ymna_

PDB Entry: 1ymn (more details), 1.45 Å

PDB Description: the study of reductive unfolding pathways of rnase a (y92l mutant)
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d1ymna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymna_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgssklpncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d1ymna_:

Click to download the PDB-style file with coordinates for d1ymna_.
(The format of our PDB-style files is described here.)

Timeline for d1ymna_: