Lineage for d1ymhe_ (1ymh E:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1018933Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1018934Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1019014Protein automated matches [190067] (3 species)
    not a true protein
  7. 1019018Species Finegoldia magna [TaxId:334413] [188140] (1 PDB entry)
  8. 1019019Domain d1ymhe_: 1ymh E: [162251]
    automated match to d1heze_
    mutant

Details for d1ymhe_

PDB Entry: 1ymh (more details), 2.6 Å

PDB Description: anti-HCV Fab 19D9D6 complexed with protein L (PpL) mutant A66W
PDB Compounds: (E:) protein l

SCOPe Domain Sequences for d1ymhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymhe_ d.15.7.1 (E:) automated matches {Finegoldia magna [TaxId: 334413]}
keevtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytwdledggnhmni
kfagk

SCOPe Domain Coordinates for d1ymhe_:

Click to download the PDB-style file with coordinates for d1ymhe_.
(The format of our PDB-style files is described here.)

Timeline for d1ymhe_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ymhf_