SCOP 1.69: Domain d1bn5_1: 1bn5 375-448

Lineage for d1bn5_1 (1bn5 375-448)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
   circularly permuted version of the "winged helix" fold

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46890] (7 PDB entries)

8. Domain d1bn5_1: 1bn5 375-448 [16224]
   Other proteins in same PDB: d1bn5_2

Details for d1bn5_1

PDB Entry: 1bn5, 1.8 Å

PDB Description: human methionine aminopeptidase 2

SCOP Domain Sequences for d1bn5_1:

Sequence; same for both SEQRES and ATOM records:

>d1bn5_1 a.4.5.25 (375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens)}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

Timeline for d1bn5_1:

• d1bn5_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bn5_1 appears in SCOP 1.67
  
• d1bn5_1 appears in SCOP 1.71
  
• d1bn5_1 appears in the current release, SCOPe 2.08, called d1bn5a1