SCOPe 2.06: Domain d1ylkc1: 1ylk C:2-163

Lineage for d1ylkc1 (1ylk C:2-163)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.0: automated matches [191506] (1 protein)
   not a true family

6. Protein automated matches [190830] (9 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [188136] (1 PDB entry)

8. Domain d1ylkc1: 1ylk C:2-163 [162239]
   Other proteins in same PDB: d1ylka2, d1ylkb2, d1ylkc2, d1ylkd2
   automated match to d1g5ca_
   complexed with scn, zn

Details for d1ylkc1

PDB Entry: 1ylk, 2 Å

PDB Description: Crystal Structure of Rv1284 from Mycobacterium tuberculosis in Complex with Thiocyanate

PDB Compounds: (C:) Hypothetical protein Rv1284/MT1322

SCOPe Domain Sequences for d1ylkc1:

Sequence; same for both SEQRES and ATOM records:

>d1ylkc1 c.53.2.0 (C:2-163) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
tvtddylannvdyasgfkgplpmppskhiaivacmdarldvyrmlgikegeahvirnagc
vvtddvirslaisqrllgtreiillhhtdcgmltftdddfkraiqdetgirptwspesyp
davedvrqslrrievnpfvtkhtslrgfvfdvatgklnevtp

Timeline for d1ylkc1:

• d1ylkc1 first appeared in SCOPe 2.01, called d1ylkc_
  
• d1ylkc1 was called d1ylkc_ in SCOPe 2.05
  
• d1ylkc1 appears in SCOPe 2.07
  
• d1ylkc1 appears in the current release, SCOPe 2.08