Lineage for d1yk5b_ (1yk5 B:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464186Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1464187Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1464196Protein Rubredoxin [57804] (8 species)
  7. 1464247Species Pyrococcus abyssi [TaxId:29292] [188135] (3 PDB entries)
  8. 1464251Domain d1yk5b_: 1yk5 B: [162233]
    automated match to d1bq8a_
    complexed with fe

Details for d1yk5b_

PDB Entry: 1yk5 (more details), 1.79 Å

PDB Description: Pyrococcus abyssi rubredoxin
PDB Compounds: (B:) rubredoxin

SCOPe Domain Sequences for d1yk5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk5b_ g.41.5.1 (B:) Rubredoxin {Pyrococcus abyssi [TaxId: 29292]}
makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie

SCOPe Domain Coordinates for d1yk5b_:

Click to download the PDB-style file with coordinates for d1yk5b_.
(The format of our PDB-style files is described here.)

Timeline for d1yk5b_: