Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (3 families) |
Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
Protein Rubredoxin [57804] (8 species) |
Species Pyrococcus abyssi [TaxId:29292] [188135] (3 PDB entries) |
Domain d1yk5b_: 1yk5 B: [162233] automated match to d1bq8a_ complexed with fe |
PDB Entry: 1yk5 (more details), 1.79 Å
SCOPe Domain Sequences for d1yk5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yk5b_ g.41.5.1 (B:) Rubredoxin {Pyrococcus abyssi [TaxId: 29292]} makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie
Timeline for d1yk5b_: