Lineage for d1yk5a_ (1yk5 A:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. Protein Rubredoxin [57804] (8 species)
  7. Species Pyrococcus abyssi [TaxId:29292] [188135] (3 PDB entries)
  8. Domain d1yk5a_: 1yk5 A: [162232]
    automated match to d1bq8a_
    complexed with fe

Details for d1yk5a_

PDB Entry: 1yk5 (more details), 1.79 Å

PDB Description: Pyrococcus abyssi rubredoxin
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1yk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk5a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus abyssi [TaxId: 29292]}
makwrckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie

SCOPe Domain Coordinates for d1yk5a_ are not available.

Timeline for d1yk5a_:

Domains from other chains:
(mouse over for more information)
d1yk5b_, d1yk5c_, d1yk5d_