Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1yk4a_ (1yk4 A:)

  1. Root: SCOP 1.75B
  2. Class g: Small proteins [56992] (90 folds)
  3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. Family g.41.5.1: Rubredoxin [57803] (5 protein domains)
  6. Protein Rubredoxin [57804] (8 species)
  7. Species Pyrococcus abyssi [TaxId:29292] [188135] (3 PDB entries)
  8. Domain d1yk4a_: 1yk4 A: [162231]
    automated match to d1bq8a_
    complexed with fe

Details for d1yk4a_

PDB Entry: 1yk4 (more details)
PDB Description: ultra-high resolution structure of pyrococcus abyssi rubredoxin w4l/r5s
PDB Compounds: (A:) rubredoxin

SCOP Domain Sequences for d1yk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yk4a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus abyssi [TaxId: 29292]}
aklsckicgyiydedegdpdngispgtkfedlpddwvcplcgapkseferie

SCOP Domain Coordinates for d1yk4a_:

Click to download the PDB-style file with coordinates for d1yk4a_.
(The format of our PDB-style files is described here.)

Timeline for d1yk4a_:

d1yk4a_ appears in SCOP 1.75A


d1yk4a_
(click for larger image)


d1yk4a_ in context of chain

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu