SCOP 1.75: Domain d1b6aa1: 1b6a A:375-448

Lineage for d1b6aa1 (1b6a A:375-448)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
   circularly permuted version of the "winged helix" fold

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46890] (18 PDB entries)
   Uniprot P50579 110-478

8. Domain d1b6aa1: 1b6a A:375-448 [16223]
   Other proteins in same PDB: d1b6aa2

Details for d1b6aa1

PDB Entry: 1b6a, 1.6 Å

PDB Description: human methionine aminopeptidase 2 complexed with tnp-470

PDB Compounds: (A:) Methionine aminopeptidase

SCOP Domain Sequences for d1b6aa1:

Sequence; same for both SEQRES and ATOM records:

>d1b6aa1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

Timeline for d1b6aa1:

• d1b6aa1 first appeared (with stable ids) in SCOP 1.55, called d1b6a_1
  
• d1b6aa1 appears in SCOP 1.73
  
• d1b6aa1 appears in SCOPe 2.01
  
• d1b6aa1 appears in the current release, SCOPe 2.08