SCOP 1.57: Domain d1xgo_1: 1xgo 195-271

Lineage for d1xgo_1 (1xgo 195-271)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [46889] (4 PDB entries)

8. Domain d1xgo_1: 1xgo 195-271 [16222]
   Other proteins in same PDB: d1xgo_2

Details for d1xgo_1

PDB Entry: 1xgo, 3.5 Å

PDB Description: methionine aminopeptidase from hyperthermophile pyrococcus furiosus

SCOP Domain Sequences for d1xgo_1:

Sequence; same for both SEQRES and ATOM records:

>d1xgo_1 a.4.5.25 (195-271) Methionine aminopeptidase, insert domain {Archaeon Pyrococcus furiosus}
gqvievpptliymyvrdvpvrvaqarfllakikreygtlpfayrwlqndmpegqlklalk
tlekagaiygypvlkei

Timeline for d1xgo_1:

• d1xgo_1 first appeared (with stable ids) in SCOP 1.55
  
• d1xgo_1 appears in SCOP 1.59
  
• d1xgo_1 appears in the current release, SCOPe 2.08, called d1xgoa1