Lineage for d1yj0a_ (1yj0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717085Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2717086Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2717087Family a.65.1.1: Annexin [47875] (10 proteins)
  6. 2717115Protein Annexin V [47883] (3 species)
  7. 2717116Species Chicken (Gallus gallus) [TaxId:9031] [47884] (3 PDB entries)
  8. 2717119Domain d1yj0a_: 1yj0 A: [162212]
    automated match to d1alaa_
    complexed with so4, zn

Details for d1yj0a_

PDB Entry: 1yj0 (more details), 2.95 Å

PDB Description: Crystal Structures of Chicken Annexin V in Complex with Zn2+
PDB Compounds: (A:) Annexin A5

SCOPe Domain Sequences for d1yj0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj0a_ a.65.1.1 (A:) Annexin V {Chicken (Gallus gallus) [TaxId: 9031]}
kytrgtvtafspfdaradaealrkamkgmgtdeetilkiltsrnnaqrqeiasafktlfg
rdlvddlkseltgkfetlmvslmrparifdahalkhaikgagtnekvlteilasrtpaev
qnikqvymqeyeanledkitgetsghfqrllvvllqanrdpdgrvdealvekdaqvlfra
gelkwgtdeetfitilgtrsvshlrrvfdkymtisgfqieetidretsgdleklllavvk
cirsvpayfaetlyysmkgagtdddtlirvmvsrseidlldirhefrknfakslyqmiqk
dtsgdyrkallllcggd

SCOPe Domain Coordinates for d1yj0a_:

Click to download the PDB-style file with coordinates for d1yj0a_.
(The format of our PDB-style files is described here.)

Timeline for d1yj0a_: