Lineage for d1yhsa_ (1yhs A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
    OPK group(?); PIM subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [118134] (118 PDB entries)
    Uniprot P11309 33-305 ! Uniprot P11309 32-308
  8. Domain d1yhsa_: 1yhs A: [162205]
    automated match to d1xqza_
    complexed with stu

Details for d1yhsa_

PDB Entry: 1yhs (more details), 2.15 Å

PDB Description: crystal structure of pim-1 bound to staurosporine
PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOPe Domain Sequences for d1yhsa_:

Sequence, based on SEQRES records: (download)

>d1yhsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlh

Sequence, based on observed residues (ATOM records): (download)

>d1yhsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgetrvpmevvllkkv
ssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavr
hchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryh
ryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwclalrps
drptfeeiqnhpwmqdvllpqetaeihlh

SCOPe Domain Coordinates for d1yhsa_ are not available.

Timeline for d1yhsa_: