SCOPe 2.07: Domain d1yhha_: 1yhh A:

Lineage for d1yhha_ (1yhh A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (22 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (63 PDB entries)

8. Domain d1yhha_: 1yhh A: [162203]
   automated match to d1qyoa_

Details for d1yhha_

PDB Entry: 1yhh, 1.5 Å

PDB Description: uncyclized precursor structure of s65a y66s g67a gfp variant

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d1yhha_:

Sequence; same for both SEQRES and ATOM records:

>d1yhha_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttlasavqcfsrypdhmkqhdffksampegyvqertisfkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyitadkqkngikanfkirhniedgsvqladh
yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

Timeline for d1yhha_:

• d1yhha_ first appeared in SCOPe 2.01
  
• d1yhha_ appears in SCOPe 2.06
  
• d1yhha_ appears in the current release, SCOPe 2.08